PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YB
Protein Properties Length: 199aa    MW: 20836.4 Da    PI: 7.7123
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097766.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB137.82.9e-4320112297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqdrflPianvsrimkk+lPanakiskda              +t+easdkcqrekrktingddllwa++tlGfedyveplk+yl+++r++ege
  XP_011097766.1  20 REQDRFLPIANVSRIMKKALPANAKISKDAXXXXXXXX---XXXITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQRFRDMEGE 111
                     89****************************98876655...5679*************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_011097766.1 112 K 112
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-4015122IPR009072Histone-fold
SuperFamilySSF471138.57E-3022121IPR009072Histone-fold
PfamPF008083.3E-152586IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.1E-116987No hitNo description
PRINTSPR006157.1E-1188106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MADSDNESGG HRDHNETSPR EQDRFLPIAN VSRIMKKALP ANAKISKDAX XXXXXXXXXX  60
ITGEASDKCQ REKRKTINGD DLLWAMTTLG FEDYVEPLKI YLQRFRDMEG EKSAMAGKGE  120
KESGGGGGNG NGSVVNMGSS GGGYEGMYMM GHQGGVGVGV GPVYGYGQQM AGGGSGKVGS  180
GYHHVGPGAG AAGASGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-3420107292Transcription factor HapC (Eurofung)
4g92_B1e-3420107292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097763.11e-132PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_011097764.11e-132PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_011097765.11e-132PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_011097766.11e-132PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-62NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A022R1753e-74A0A022R175_ERYGU; Uncharacterized protein
STRINGVIT_19s0015g00440.t011e-69(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-60nuclear factor Y, subunit B3